A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10881 |
Swiss-prot Accession number | P09477 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Platichthys flesus (European flounder) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 51 Amino acids |
Molecular weight | 5755 |
References | 1 PubMed abstract 3556313 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | VVPPQHLCGAHLVDALYLVCGERGFFYTPK |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (1-30) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10882 |
Swiss-prot Accession number | P09477 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Platichthys flesus (European flounder) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 51 Amino acids |
Molecular weight | 5755 |
References | 1 PubMed abstract 3556313 |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVEQCCHKPCNIFDLQNYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (31-51) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11117 |
Swiss-prot Accession number | P68956 (Sequence in FASTA format) |
Description | Glucagon. |
Source organism | Platichthys flesus (European flounder) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 29 Amino acids |
Molecular weight | 3508 |
References | 1 PubMed abstract 3556313 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSEGTFSNDYSKYLETRRAQDFVQWLKNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11139 |
Swiss-prot Accession number | P21780 (Sequence in FASTA format) |
Description | Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14] (Fragments). |
Source organism | Platichthys flesus (European flounder) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 73 Amino acids |
Molecular weight | 7989 |
References | 1 PubMed abstract 2889597 |
Domain Name | Somatostatin |
Hormone Name | [Tyr21,Gly24]-somatostatin-28 |
Mature Hormone Sequence | SIEPPNNLPPRERKAGCKNFYWKGFTSC |
Position of mature hormone in Pre-Hormone protein | 28 Residues from position (46-73 |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11140 |
Swiss-prot Accession number | P21780 (Sequence in FASTA format) |
Description | Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14] (Fragments). |
Source organism | Platichthys flesus (European flounder) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 73 Amino acids |
Molecular weight | 7989 |
References | 1 PubMed abstract 2889597 |
Domain Name | Somatostatin |
Hormone Name | [Tyr7,Gly10]-somatostatin-14 |
Mature Hormone Sequence | AGCKNFYWKGFTSC |
Position of mature hormone in Pre-Hormone protein | 14 Residues from position (60-73) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |